SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001105299.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001105299.1.72884
Domain Number 1 Region: 198-316
Classification Level Classification E-value
Superfamily EF-hand 2.21e-35
Family Osteonectin 0.0087
Further Details:      
 
Domain Number 2 Region: 286-379
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 6.67e-26
Family Thyroglobulin type-1 domain 0.00064
Further Details:      
 
Domain Number 3 Region: 135-180
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000846
Family Ovomucoid domain III-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001105299.1.72884
Sequence length 424
Comment PREDICTED: testican-2 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MHAPGCGRLVLPLLLLTAAALAEGDAKGLKEGETPGNFMEDEQWLSSISQYSGKIKHWNR
FRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCIAQGYQRAMCISRKKLEHR
IKQPTVKLHGNKDSICKPCHMAQLASVCGSDGHTYSSVCKLEQQACLSNKQLAVRCDGPC
PCPTEQAATSTADGKPETCTGQDLADLGDRLRDWFQLLHENSKQNGSASSAASPASGLDK
SLGASCKDSIGWMFSKLDTSADLFLDQTELAAINLDKYEVCIRPFFNSCDTYKDGRVSTA
EWCFCFWREKPPCLAELERVQIQEAAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQ
LGLELTGTRTHGSPDCDDIVGFSGDFGSGVGWEDEEEKETEEAGEEAEEEEGEAGEADDG
GYIW
Download sequence
Identical sequences F6UWN5
9544.ENSMMUP00000002824 ENSMMUP00000002824 ENSMMUP00000002824 XP_001105299.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]