SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001106523.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001106523.1.72884
Domain Number 1 Region: 310-369
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000398
Family RING finger domain, C3HC4 0.033
Further Details:      
 
Domain Number 2 Region: 96-120
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000366
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  XP_001106523.1.72884
Domain Number - Region: 239-263
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0055
Further Details:      
 
Domain Number - Region: 395-424
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000549
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001106523.1.72884
Sequence length 507
Comment PREDICTED: probable E3 ubiquitin-protein ligase makorin-3 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MEEPAAPSEAQEAAGAQAGAEAAGEGVSGPDLPVCEPSRESAAPDSALPHAPVGWAPFPV
APVPAHLRTGGLRPAPASGGGAWRNPFPSRSSGIWTKQIICRYYIHGQCKEGENCRYSHD
LSGRKMATEGSVSPPGASAGGGPSTAAHIEPPTQEVAEAPPAASSLSLPVIGSAAERGFF
EAERDNADRGAAGGAGVESWADAIEFVPGQPYRGRWVASAPEAPPQSSETERKQMAVGRG
LRFCYYASRGVCFRGESCMFLHGDICDMCGLQALHPMDAAQREDHIRACIEAHEKDMELS
FAVQRGMDKVCGICMEVVYEKANPNDRRFGILSNCNHTFCIRCIRRWRSARQFDNRIIKS
CPQCRVTSDLVVPSEFWVEEEEEKQKLIQQYKEAMSNKACRYFAEGRGNCPFGDTCFYKH
EYPEGWGDEPPGPGGGSFGAYWHQLVEPVRMGEGDMLYKSRKKELVVLRLASLLFKRFLL
LRDELPFSEDQWDLLHYELEEYFNLNL
Download sequence
Identical sequences F7B6F3 G7PAF8
ENSMMUP00000010347 XP_001106523.1.72884 ENSMMUP00000010347 9544.ENSMMUP00000010347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]