SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001111282.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001111282.1.72884
Domain Number - Region: 118-280
Classification Level Classification E-value
Superfamily Tropomyosin 0.034
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 649-742
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0445
Family Myosin rod fragments 0.0082
Further Details:      
 
Domain Number - Region: 253-343
Classification Level Classification E-value
Superfamily TROVE domain-like 0.0667
Family TROVE domain-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001111282.1.72884
Sequence length 829
Comment PREDICTED: outer dense fiber protein 2 isoform X4 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MSASSSGGSPRFPSCGKNGVTSLTQKKVLRAPCGAPSVTVTKSHKRGMKGDTVNVRRSVR
VKTKVPWMPPGKSSARPVGCKWENPPHCLEITPPSSEKLVSVMRLSDLSTEDDDSGHCKM
NRYDKKIDSLMNAVGCLKSEVKMQKGERQMAKRFLEERKEELEEVAHELAETEHENTVLR
HNIERMKEEKDYTILQKKHLQQEKECLMSKLVEAEMDGAAAAKQVMALKDTIGKLKTEKQ
MTCTDINTLTRQKELLLQKLSTFEETNRTLRDLLREQHCKEDSERLMEQQGALLKRLAEA
DSEKARLLLLLQDKDKEVEELLQEIQCEKAQAKTASELSKSMESMRGHLQAQLRSKEAEN
SRLCMQIKNLERSGNQHKAEVEAIMEQLKELKQKGDRDKESLKKAIRAQKERAEKSEEYA
EQLHVQLADKDLYVAEALSTLESWRSRYNQVVKDKGDLELEIIVLNDRVTDLVNQQQTLE
EKMREDRDSLVERLHRQTAEYSAFKLENERLKASFAPMEDKLNQAHLEVQQLKASVKNYE
GMIDNYKSQVMKTRLEADEVAAQLERCDKENKILKDEMNKEIEAARRQFQSQLADLQQLP
DILKITEAKLAECQDQLQGYERKNIDLTAIISDLRSRIEHQGDKLEMAREKHQASQKENK
QLSLKVDELERKLEATSAQNIEFLQVIAKREEAIHQSQLRLEEKTRECGTLARQLESAIE
DARRQVEQTKEHALSKERAAQNKILDLETQLSRTKTELSQLRRSRDDADRRYQSRLQDLK
DRLEQSESTNRSMQNYVQFLKSSYANVFGDGPYTTFLTSSPIRSRSPPA
Download sequence
Identical sequences A0A1D5Q803 G7PRF5
ENSMMUP00000019534 XP_001110960.2.72884 XP_001111282.1.72884 XP_005580796.1.63531 XP_014972170.1.72884 XP_015291869.1.63531 XP_015291870.1.63531 9544.ENSMMUP00000019534 ENSMMUP00000039916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]