SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001112864.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001112864.1.72884
Domain Number 1 Region: 268-382
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.12e-33
Family PDI-like 0.0059
Further Details:      
 
Domain Number 2 Region: 398-502
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.34e-30
Family PDI-like 0.0041
Further Details:      
 
Domain Number 3 Region: 115-258
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-26
Family PDI-like 0.0096
Further Details:      
 
Domain Number 4 Region: 35-142
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000824
Family ERP29 N domain-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001112864.1.72884
Sequence length 519
Comment PREDICTED: protein disulfide-isomerase A5 isoform X1 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MARAGPAWLLLAIWVVLPLWLSSAKVSSLIERISDPKDLKKLLRTRNNVLVLYSKSEAAA
ENHLRLLSIVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHT
EYNRAVTFKSIVAFLKDPKGPPLWEEDPGAKDVVHLDSEKDFRRLLKKEEKPLLIMFYAP
WCSMCKRMMPHFQKAATQLRGHAVLAGMNVYSSEFENIKEEYSVRGFPTICYFEKGRFLF
QYDNYGSTAEDILEWLKNPQPPQPQVPETPWADEGGSVYHLTDEDFDQFVKEHSSVLVMF
HAPWCGHCKKMKPEFEKAAEALHGEADSSGVLAAVDATVNKALAERFHISEFPTLKYFKN
GEKYAVPVLRTKKKFLEWMQNPEAPPPPEPTWEEQQTSVLHLVGDNFRETLKKKKHTLVM
FYAPWCPHCKKVIPHFTAAADAFKDDRKIACAAVDCVKDKNQDLCQQEAVKGYPTFHYYH
YGKFTEKYDSDRTELGFTNYIRALREGDHERLGKKKEEL
Download sequence
Identical sequences F7CEQ3
ENSMMUP00000010118 ENSMMUP00000010118 9544.ENSMMUP00000010118 XP_001112864.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]