SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001117117.1.72884 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001117117.1.72884
Domain Number 1 Region: 140-265
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.75e-22
Family Voltage-gated potassium channels 0.0028
Further Details:      
 
Domain Number 2 Region: 7-31,79-147
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-22
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001117117.1.72884
Sequence length 499
Comment PREDICTED: potassium channel subfamily K member 5 [Macaca mulatta]; AA=GCF_000772875.2; RF=representative genome; TAX=9544; STAX=9544; NAME=Macaca mulatta; AL=Chromosome; RT=Major
Sequence
MVDRGPLLTSAIIFYLAIGAAIFEVLEEPHWKEAKKNYYTQKLHLLKEFPCLGQEGLDKI
LEVVSDAAGQGVAITGNQTFNNWNWPNAMIFAATVITTIGYGNVAPKTPAGRLFCVFYGL
FGVPLCLTWISALGKFFGGRAKRLGQFLTRRGVSLRKAQITCTVIFIVWGVLVHLVIPPF
VFMVTEGWNYIEGLYYSFITISTIGFGDFVAGVNPSANYHALYRYFVELWIYLGLAWLSL
FVNWKVSMFVEVHKAIKKRRRRRKESFESSPHSRKALQVKGSAASKDVNIFSFLSKKEET
YNDLIKQIGKKAMKTSGGGETGPGPGLGPQGGGLPALPPSLAPLVVYSKNRVPTLEEVSQ
TLRSKGHVSRPPDEEAVARAPEDSSPAPEVFMNQLDRISEECEPWDAQDYHPLIFQDASI
TFVNAEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSDESTFTSTESELS
VPYEQLMNEYNKANSPKGT
Download sequence
Identical sequences A0A2K5VDV3 F6VWZ8
ENSMMUP00000011777 ENSMMUP00000033743 ENSMMUP00000011777 9544.ENSMMUP00000033743 XP_001117117.1.72884 XP_005553165.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]