SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001142892.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001142892.1.37143
Domain Number 1 Region: 42-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000221
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001142892.1.37143
Sequence length 160
Comment PREDICTED: protransforming growth factor alpha isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MVPSAGQLALFALGIVLAACQALENSTSPLSADPPVAAAVVSHFNDCPDSHTQFCFHGTC
RFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
Download sequence
Identical sequences A0A2J8N499 P01135
ENSNLEP00000012418 ENSP00000295400 ENSP00000475235 9606.ENSP00000295400 ENSPTRP00000020654 ENSPTRP00000020654 gi|4507461|ref|NP_003227.1| NP_003227.1.87134 NP_003227.1.92137 XP_001142892.1.37143 XP_003262568.1.23891 XP_018877140.1.27298 ENSP00000295400 ENSNLEP00000012418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]