SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001147664.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001147664.1.37143
Domain Number 1 Region: 424-580
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-26
Family SPRY domain 0.012
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-17
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number 3 Region: 174-237
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000013
Family B-box zinc-binding domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001147664.1.37143
Sequence length 642
Comment PREDICTED: tripartite motif-containing protein 47 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MDGSGPFSCPICLEPLREPVTLPCGHNFCLACLGALWPHRGASGAGGPGGAARCPLCQEP
FPDGLQLRKNHTLSELLQLRQGSGPGPGPGPAPALAPEPSAPSAPPSAPPSAPEPSAPCA
PEPWPAGEEPVRCDACLEGAALPAALSCLSCLASFCPAHLGPHERSPALRGHRLVPPLRR
LEESLCPRHLRPLERYCRAERVCLCEACAAQEHRGHELVPLEQERALQEAEQSKVLSAVE
DRMDELGAGIAQSRRTVALIKSAAVAERERVSRLFADAAATLQGFQTQVLGFIEEGEAAM
LGRSQGDLRRQEEQRSRLSRARQNLSQVPEADSVSFLQELLALRLALEDGCGPGPGPPRE
LSFTKSSQAVRAVRDMLAVACVNQWEQLRGPGGNEDGPQKLDSEADAEPQDLESTNLLES
EAPRDYFLKFAYIVDLDSDTADKFLQLFGTKGVKRVLCPINYPLSPTRFTHCEQVLGEGA
LDRGTYYWEVEIIEGWVSVGVMAEDFSPQEPYDRGRLGRNAHSCCLQWNGRSFSVWFHGL
EAPLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKASRPRRGGIPASPIDPFQSR
LDSHFAGLFTHRLKPAFFLESVDAHLQIGPLKKSCISVLKRR
Download sequence
Identical sequences H2QDW6
ENSPTRP00000016415 ENSPTRP00000016415 XP_001147664.1.37143 9598.ENSPTRP00000016415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]