SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001148687.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001148687.1.37143
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.83e-25
Family Ubiquitin-related 0.00000465
Further Details:      
 
Domain Number 2 Region: 569-620
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000924
Family UBA domain 0.0014
Further Details:      
 
Domain Number 3 Region: 202-254
Classification Level Classification E-value
Superfamily ARM repeat 0.00000691
Family Mo25 protein 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001148687.1.37143
Sequence length 624
Comment PREDICTED: ubiquilin-2 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAENGESSGPPRPSRGPAAAQGSAAAPAEPKIIKVTVKTPKEKEEFAVPENSSVQQFKEA
ISKRFKSQTDQLVLIFAGKILKDQDTLIQHGIHDGLTVHLVIKSQNRPQGQSTQPSNAAG
TNTTSASTPRSNSTPISTNSNPFGLGSLGGLAGLSSLGLSSTNFSELQSQMQQQLMASPE
MMIQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRNPEISHLLNNPDIMRQTLEIARN
PAMMQEMMRNQDLALSNLESIPGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSS
SGEGTQPSRTENRDPLPNPWAPPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYV
ASIFSTPGMQSLLQQITENPQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANP
QLQEQMRPQLPAFLQQMQNPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGV
GVGVLGTAIGPVGPVTPIGPIGPIVPFTPIGPIGPIGPTGPAGPPGSTGSGGPTGPTVSS
AAPSETTSPTSESGPNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREAN
LQALIATGGDINAAIERLLGSQPS
Download sequence
Identical sequences G3RLD1 H2QYP6
XP_001148687.1.37143 XP_003807481.1.60992 XP_004064307.1.27298 9598.ENSPTRP00000037734 ENSPTRP00000037734 ENSPTRP00000037734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]