SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001154646.2.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001154646.2.37143
Domain Number - Region: 17-55
Classification Level Classification E-value
Superfamily Prefoldin 0.0392
Family Prefoldin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001154646.2.37143
Sequence length 219
Comment PREDICTED: charged multivesicular body protein 5 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MNRLFGKAKPKAPPPSLTDCIGTVDSRAESIDKKISRLDAELVKYKDQIKKMREGPAKNM
VKQKALRVLKQKRMYEQQRDNLAQQSFNMEQANYTIQSLKDTKTTVDAMKLGVKEMKKAY
KQVKIDQIEDLQDQLEDMMEDANEIQEALSRSYGTPELDEDDLEAELDALGDELLADEDS
SYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS
Download sequence
Identical sequences A0A0D9RC66 A0A2I3FQA2 A0A2J8XIU5 A0A2K5HF94 A0A2K5NZR9 A0A2K5YUB5 A0A2K6CTZ4 F6TSB3 G3RK77 G7PS50 H2QX51 Q5RBR3 Q9NZZ3
ENSP00000223500 GO.42278 ENSMMUP00000026530 ENSMMUP00000026530 ENSP00000223500 ENSPPYP00000021442 ENSNLEP00000006287 ENSP00000223500 ENSPPYP00000021442 gi|189409150|ref|NP_057494.3| ENSPTRP00000035664 ENSGGOP00000016137 ENSNLEP00000006287 ENSGGOP00000016137 9544.ENSMMUP00000026530 9600.ENSPPYP00000021442 9606.ENSP00000223500 NP_001125453.1.23681 NP_001253497.1.72884 NP_057494.3.87134 NP_057494.3.92137 XP_001154646.2.37143 XP_003830167.1.60992 XP_004047971.1.27298 XP_005581585.1.63531 XP_007967192.1.81039 XP_011746297.1.29376 XP_011781930.1.43180 XP_011835404.1.47321 XP_011924688.1.92194 ENSPTRP00000035664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]