SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001156221.3.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001156221.3.37143
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000353
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 80-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000209
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001156221.3.37143
Sequence length 173
Comment PREDICTED: transcription factor HES-2 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLW
RRAASATLDGGRAGDSSGPSAPAPAPASAPEPASAPVPSPPSPPCGPGLWRPW
Download sequence
Identical sequences G3SAB1 H2PXW9 Q9Y543
ENSP00000367067 ENSP00000367065 NP_061962.2.87134 NP_061962.2.92137 XP_001156221.3.37143 XP_016808605.1.37143 XP_018865955.1.27298 ENSP00000367065 gi|63055047|ref|NP_061962.2| 9598.ENSPTRP00000000160 9606.ENSP00000367065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]