SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001162104.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001162104.1.37143
Domain Number 1 Region: 12-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.43e-49
Family Galectin (animal S-lectin) 0.0000323
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001162104.1.37143
Sequence length 135
Comment PREDICTED: galectin-1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
MAADGDFKIKCVAFD
Download sequence
Identical sequences H2QLM5 P09382
ENSPTRP00000024707 ENSP00000215909 NP_002296.1.87134 NP_002296.1.92137 XP_001162104.1.37143 XP_003821617.1.60992 ENSPTRP00000024707 gi|4504981|ref|NP_002296.1| 3t2t_A 3t2t_B 9598.ENSPTRP00000024707 9606.ENSP00000215909 ENSP00000215909 NYSGRC-LECT-ENSP00000215909 ENSP00000215909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]