SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001162210.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001162210.1.37143
Domain Number 1 Region: 67-355
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.94e-124
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000000218
Further Details:      
 
Domain Number 2 Region: 369-481
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 4.58e-27
Family Anticodon-binding domain of Class II aaRS 0.000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001162210.1.37143
Sequence length 485
Comment PREDICTED: DNA polymerase subunit gamma-2, mitochondrial [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MRSRVAVRACHKVCRCLLSGFGGRVDAGPPELLTERSSPKGGHVKSHAELEGNGEHPEAP
GSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVV
FREQVFPVDALHHKPGPLLPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGK
LRENLLHGALEHYVNCLDVVNKRLPYGLAQIGVCFHPVFDTKQIPNGVKSIGEKTEASLV
WFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELI
ETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENS
FTRKKNLHRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLET
MQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYIS
SAKNV
Download sequence
Identical sequences H2QDP3
ENSPTRP00000016205 9598.ENSPTRP00000016205 ENSPTRP00000016205 XP_001162210.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]