SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001166826.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001166826.1.37143
Domain Number 1 Region: 162-234
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.67e-19
Family Complement control module/SCR domain 0.0000229
Further Details:      
 
Domain Number 2 Region: 223-284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.75e-16
Family Complement control module/SCR domain 0.0000126
Further Details:      
 
Domain Number 3 Region: 98-172
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000553
Family Complement control module/SCR domain 0.0000278
Further Details:      
 
Domain Number 4 Region: 36-102
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000148
Family Complement control module/SCR domain 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001166826.1.37143
Sequence length 381
Comment PREDICTED: complement decay-accelerating factor isoform X10 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MTVARPRVPAALPLLGELPRLLLLVLLCLPAVWGDCGLPPEVPNAQPALEGRTSFPEDTV
ITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFP
VGTVVEYECRPGYRREPSLSTKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPDGI
LFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIHCPAPPQIDNGIIQGER
DHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPT
TVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSGTTRLLS
GHTCFTLTGLLGMLVTVGLLT
Download sequence
Identical sequences K7D1R1
XP_001166826.1.37143 ENSPTRP00000056033 ENSPTRP00000056033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]