SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001168039.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001168039.1.37143
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.000732
Family Fibronectin type I module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001168039.1.37143
Sequence length 139
Comment PREDICTED: prostate-associated microseminoprotein [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MALRMLWAGQAKGILGGWGIICLVMSLLLQHPGVYSKCYFQAQAPCHYEGKYFTLGESWL
RNDCFHCTCLHPVGVGCCDTSQHPIDFPAGCEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
PEWGSANTPVPGAPAPHSS
Download sequence
Identical sequences H2RBN6
XP_001168039.1.37143 ENSPTRP00000056006 ENSPTRP00000056006 9598.ENSPTRP00000056006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]