SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001171475.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001171475.1.37143
Domain Number 1 Region: 22-99
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000342
Family Snake venom toxins 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001171475.1.37143
Sequence length 124
Comment PREDICTED: sperm acrosome membrane-associated protein 4 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MVLCWLLLLVMALPPGTTGVKDCVFCELTDSMQCPGTYMHCGDDEDCFTGHGVAPGTGPV
INKGCLRATSCGLEEPVSYRGVTYSLTTNCCTGRLCNRAPSSQTVGATTSLALGLGMLLP
PRLL
Download sequence
Identical sequences A0A140VJU1 A0A2I3TN96 Q8TDM5
ENSPTRP00000019288 ENSP00000312774 ENSP00000312774 9598.ENSPTRP00000019288 9606.ENSP00000312774 gi|19424138|ref|NP_598005.1| NP_598005.1.87134 NP_598005.1.92137 XP_001171475.1.37143 XP_003814134.1.60992 ENSPTRP00000019288 NYSGRC-19424138 ENSP00000312774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]