SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001172719.3.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001172719.3.37143
Domain Number 1 Region: 186-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-57
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily POZ domain 4.19e-33
Family Tetramerization domain of potassium channels 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001172719.3.37143
Sequence length 585
Comment PREDICTED: potassium voltage-gated channel subfamily C member 1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVIFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRADSKLNGEVAKAALANEDCPHIDQALTPDEGLPFTRSGTR
ERYGPCFLLSTGEYACPPGGGMRKDLCKESPVIAKYMPTEAVRVT
Download sequence
Identical sequences A0A2K5RPN7 G1S7P7 H0X4A3 H2NDZ7 H2Q386
ENSOGAP00000010015 NP_001106212.1.87134 NP_001106212.1.92137 XP_001172719.3.37143 XP_003254331.1.23891 XP_003781198.1.62490 XP_017381313.1.71028 ENSOGAP00000010015 9606.ENSP00000265969 ENSPTRP00000005944 ENSPTRP00000005944 ENSP00000265969 ENSP00000265969 ENSPPYP00000003960 gi|163792201|ref|NP_001106212.1| ENSNLEP00000021536 ENSP00000265969 ENSNLEP00000021536 ENSPPYP00000003960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]