SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001174751.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001174751.1.37143
Domain Number 1 Region: 30-260
Classification Level Classification E-value
Superfamily L domain-like 4.32e-41
Family Ngr ectodomain-like 0.0051
Further Details:      
 
Weak hits

Sequence:  XP_001174751.1.37143
Domain Number - Region: 316-393
Classification Level Classification E-value
Superfamily FAS1 domain 0.00381
Family FAS1 domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001174751.1.37143
Sequence length 440
Comment PREDICTED: oligodendrocyte-myelin glycoprotein [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MEYQILKMSLCLFILLFLTPGILCICPLQCICTERHRHVDCSGRNLTTLPSGLQENIIHL
NLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTA
YQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWTVPTNMPSKLHIVDLSNNSLT
QILPGTLINLTNLTHLYLHNNKFTFIPDQSFDQLFQLQEITLYNNRWSCDHKQNITYLLK
WMMETKAHVIGTPCSTQISSLKEHNMYPTPSGFTSSLFTVSGMQTVDTINSLSVVTQPKV
TKIPKQYRTKETTFGATLSKDTTFTSTDKAFVPYPEDTSTETINSHEAAAATLTIHLQDG
MVTNTSLTSSTKSSPTPMTLSITSGMPNNFSEMPQQSTTLNLWREETTTNVKTPLPSVAN
AWKVNASFLLMLNVVVMLAV
Download sequence
Identical sequences H2QCM1
9598.ENSPTRP00000015314 ENSPTRP00000015314 ENSPTRP00000015314 XP_001174751.1.37143 XP_003812030.1.60992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]