SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001174802.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001174802.1.37143
Domain Number 1 Region: 257-424
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-42
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 20-91
Classification Level Classification E-value
Superfamily RING/U-box 2.78e-16
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001174802.1.37143
Sequence length 436
Comment PREDICTED: E3 ubiquitin-protein ligase RNF135 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAGLGLGPGPGSAVPVWLAEDDLGCIICQGLLDWPATLPCGHSFCRHCLEALWGARGARR
WACPTCRQGAAQQPQLRKNTLLQDLADKYRRAAREIQAGSDPAHCPCPGSSPRSSAAARP
RRRPELQRVAVEKSVTEVGQELTELVEHLVDIVRSLQNQRPLSESGPDNELSILGKAFSS
GVDLSMASPKLVTSDTAAGKIRDILHDLEEIQEKLQENVTRKEAPEAQMQGELLEAPSSS
SCPLPDQSHPALRRASRFAQWAIHPTFNLKSLSCSLEVSKDSRTVTVSHRPQPYRWSCER
FSTSQVLCSQALSSGKHYWEVDTRNCSHWAVGVASWEMSRDQVLGRTMDSCCVEWKGTSQ
LSAWHMVKETVLGSDRPGVVGIWLNLEEGKLAFYSVDNQEKLLYECTISASSPLYPAFWL
YGLHPGNYLIIKQVKV
Download sequence
Identical sequences H2QCL9
9598.ENSPTRP00000015306 XP_001174802.1.37143 ENSPTRP00000015306 ENSPTRP00000015306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]