SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001225304.1.25026 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001225304.1.25026
Domain Number 1 Region: 20-317
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 5.34e-46
Family Rhamnogalacturonase B, RhgB, N-terminal domain 0.042
Further Details:      
 
Domain Number 2 Region: 424-640
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-21
Family Rhamnogalacturonase B, RhgB, C-terminal domain 0.082
Further Details:      
 
Domain Number 3 Region: 321-419
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000000706
Family Rhamnogalacturonase B, RhgB, middle domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001225304.1.25026
Sequence length 642
Comment hypothetical protein CHGG_07648 [Chaetomium globosum CBS 148.51]; AA=GCF_000143365.1; RF=representative genome; TAX=306901; STAX=38033; NAME=Chaetomium globosum CBS 148.51; strain=CBS 148.51; AL=Scaffold; RT=Major
Sequence
MKLCFLSLFPLWADIASATITATESSSSINVKNDRLTFSVSKSAGTINTLTLDGQDLLGS
GGRLYLDCHCDSGYWNGGSFQLYKGTDKSGTAYAGVRISAKVDSGRTFESYYFLRDGETG
LHTFGRAAYPNGGGLGEMRFLFRPSTTIWNHLSSSDEMWSVLPTDAGRTTVQDTTYRISG
DGINAKYRTQMSDYFSKYMFAESWEYHTHHGLFSDGQGTRDGSTYGAWLVMNTKDTYYNG
PKWSDLTVDGIVYNYIISNHHGNGNPDTQKFDRTFGPQYYYFNKGPKGSSVNDLRSDAGR
FADPSWNADFYDSIAQHVPGYLPTSGRGTWNGRIHLPDGVTKAIAVLASNGRDFQDNNLA
TKARQYWGEVSPNGEITIPRVAAGTYRLTVYGTGIFGQYIQDNVVVKAGAATTTTATWTP
ESAGTELWRIGTPDRSSGDFRHGSERDTTRTNKPNQYRLYWAVHDFPKDFPNGVNFHVGK
SDIKRDFNYMQWSVFGGKGNSIRPDPYYTNVNAWNVTFDATSDQLEGKKQATLTIQLAGV
KTSAGNTDDTGKAFANLDYTVTVNGRALPVWTIPANHSSSCGARSAASCYNTRNLWTFDA
SYLKQGLNTFTLALPARATAPESAVLPESVYLQYDALRLEVA
Download sequence
Identical sequences Q2GWK6
XP_001225304.1.25026 CHGT_07648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]