SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001243497.2.59393 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001243497.2.59393
Sequence length 114
Comment hypothetical protein CIMG_13148 [Coccidioides immitis RS]; AA=GCF_000149335.2; RF=representative genome; TAX=246410; STAX=5501; NAME=Coccidioides immitis RS; strain=RS; AL=Scaffold; RT=Major
Sequence
MNLNTVIDSPNSDAVPTVFTEAQNSQDSLIQPVSRTTSAPIKNSKIQNEYSPASPSKIQK
EGPPTLPHEIQQEINSIANYSDTSMDLDTVIDSSNPDTIPTAFTEVQNPQDSLI
Download sequence
Identical sequences J3KA90
CIMG_13148T0 XP_001243497.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]