SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001271185.1.35617 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001271185.1.35617
Domain Number 1 Region: 3-117
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.67e-40
Family Calponin-homology domain, CH-domain 0.0000215
Further Details:      
 
Domain Number 2 Region: 165-233
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.06e-16
Family EB1 dimerisation domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001271185.1.35617
Sequence length 249
Comment EB1 domain protein [Aspergillus clavatus NRRL 1]; AA=GCF_000002715.2; RF=representative genome; TAX=344612; STAX=5057; NAME=Aspergillus clavatus NRRL 1; strain=NRRL 1; AL=Scaffold; RT=Major
Sequence
MGESRQELLAWLNNLLQLNLTKIEQCGTGAAYCQIFDSIFMDVPMARVKFNVNTEYAYLQ
NFKVLQNVFARHQVDKPIPVQQLTKCRMQDNLEFLQWIKKYWDQHYPGGDYDAVGRRKAS
GGPPASAAGSRSGASSSTGATRRGATPTTGGVRPRAAAAPSGANVAALQQEIATQKEAIS
GLEKERDFYFAKLRDIELLLQNAIEADPELEKEEDTLVKHIQGILYSTEEGFEIPAEAEA
EAADELETF
Download sequence
Identical sequences A1CKT5
XP_001271185.1.35617 ACLA_039750 5057.CADACLAP00003996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]