SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001303202.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001303202.1.43485
Domain Number 1 Region: 92-327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.88e-62
Family RecA protein-like (ATPase-domain) 0.0000000115
Further Details:      
 
Domain Number 2 Region: 12-75
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000000549
Family DNA repair protein Rad51, N-terminal domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001303202.1.43485
Sequence length 329
Comment DNA repair protein RAD51 homolog [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MDTEVAQEGAAGPLLIQTLEKQGIAAGDIKKLQEAGYNTVESVAFTTKKQLITVKGISEA
KADKIMAAAAQLVPMGFASASDYNQIRKEMVYLTTGSTELDKLLGGGIETGSVTEIFGEF
RTGKTQLCHTLAVTCQLPIENGGGQGKCLWIDTEGTFRPERIIPIAQRFGLDPDDVMDNI
AYARAYNSDHQSQLLVTASAMMAEAHYALLIVDSSTNLYRTDYSGRGELSARQMHLGQFL
RNIQRLADEYGIAVVITNQVVAQVDGAAMFVSDPKKPIGGNIMAHASQTRLSLRKGRGET
RVCKIYDSPSLPENEATFQITNGGITDAE
Download sequence
Identical sequences A2FXT7
5722.A2FXT7 XP_001303202.1.43485 87076.m00035 gi|121884563|gb|EAX90272.1| gi|123408472|ref|XP_001303202.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]