SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001306639.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001306639.1.43485
Domain Number 1 Region: 326-456
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 7.19e-19
Family Staphylococcal nuclease 0.0065
Further Details:      
 
Domain Number 2 Region: 3-152
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.48e-18
Family Staphylococcal nuclease 0.014
Further Details:      
 
Domain Number 3 Region: 480-614
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.0000000000209
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 4 Region: 648-739
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.00000000218
Family Tudor domain 0.017
Further Details:      
 
Domain Number 5 Region: 178-318
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 0.00000000981
Family Staphylococcal nuclease 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001306639.1.43485
Sequence length 828
Comment Tudor domain containing protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSSQLKGIVAGILSGDSLIVRFVDNVQTQVICLEHLVAPKFGRSDGTFPDEPHGYASWEY
LRDLCIGKRVIVHSNNPSNQTRTHPAFGPLTVTFTKIELYETQEDIGILACQNGWAKLRE
TKSVYPKHASYIAELTKAQEAAQAAKRGIWSETPGFVRQLPQKPNVEQILTTREFDCNID
GIKAATILSVFLLPNHENIYLNLAGCKVCYFKEDDPIREESKKDSINKFLNRKLRIRITS
YLESNFQSYQNQANEIPSFVGCIITPKMDLAVADSIKKGYATFYKKTADQCLDPNLYIHR
QLLAQKEKAGFWAKNEPQSRINTNLQQMNGIVTSVRGSSGLYVLVEGQRKVIYFNDIHVP
RFSTTVGCESNGFEAREFLRQNYRQKYFTIEIEAQFEDHLYGTISMKGKSINEDLVEKGL
ATVDKDPVCGVPSSKHAALVAAEERAKAAHVGVHASVTPDPFKFTDLTYTKNLNDKLNEY
KGHRFHCIIEHILSTTRYTVLLTEEKVLIRVALNGLLPIAPNDHFGHDAKAFCMDNFLNT
EAEIEILSLDEHTGTFYVNMYDSEKKNIAAKILMRGYSEIRPKILKSNEEKIPQELIDAQ
DKGKSFNEGLWQDKTRHLQDLQMGTVYPVSVVCVSTPTNIVIQHNGEALKTIAKELADMK
LDESRFTEIPLKNDCLVYHVKNQSFRVRIEQINQNEKTATVRLIDYCTSTEAKFDDLYKL
PPNLYTIPPQGRQVVLAGLQEVPKSPEKTKEDTRFIYELIQNACLYMHLVSDKDNDPSVI
LLDREKMEEAGSLSQVIIQKRMATYQEVPNLPPQFNNIFEILKNVKPE
Download sequence
Identical sequences A2FN11
5722.A2FN11 gi|121888225|gb|EAX93709.1| gi|123424702|ref|XP_001306639.1| XP_001306639.1.43485 96086.m00069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]