SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001307139.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001307139.1.43485
Domain Number 1 Region: 61-200
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.35e-16
Family Retroviral integrase, catalytic domain 0.017
Further Details:      
 
Weak hits

Sequence:  XP_001307139.1.43485
Domain Number - Region: 300-329
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0572
Family Tudor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001307139.1.43485
Sequence length 358
Comment Integrase core domain containing protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSLKEVFESSPWRSFKKFYEAAKNAGFNDRTEIKRFYDENIVHQVKVNPYDYYLPIYSKT
HDAYQFDTLVQSKKGRKPPFLIFINVNTRKAFAYIMKNKGTKEVLRVLQTFVAEHHPTSL
TSNQDSAYLSNEITEFLIKHNVTHYTTEDHNHNILGIINRFIRTLRDLNKERDFTEESMN
KVINAYNKSTHNSTGFKPNEMTSKEEDEYIKQKRMLTEERRSSSLLPGTKVRIILEHKPN
EKVRNQLSDDYYIVDSSQGNSYLIKAADHSVAFYPRFRLVESENGRLAKTVDEAKRGIVN
KIVSYDEDKDEYTVIYEGGVDDKIPSRNLRESNPTHLSELEKDYWKDKNKPKLIKKFL
Download sequence
Identical sequences A2FLJ5
5722.A2FLJ5 XP_001307139.1.43485 92775.m00074 gi|121888751|gb|EAX94209.1| gi|123426908|ref|XP_001307139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]