SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001319510.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001319510.1.43485
Domain Number 1 Region: 75-305
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.7e-32
Family ROO N-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001319510.1.43485
Sequence length 341
Comment Zn-dependent hydrolase of beta-lactamase [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MKSNQQVYGCIPENLPSYNDAHHANGYFVNNHGYPYAEYEDIGMGTARLFFKFFFGEKDV
TREMPHRNPKSDFNLGNGIRDWWIGHATNLIQIKDKFILTDPIFEKSCSPLKIGNSRKTP
AACKIEELPKISYVLISHSHYDHLNKGSVKKIKSLFPECHFLVPLGVGKILSSWGIKNYT
EFDWRTHLTIEDINFTCFPARHGSARSLSDSNVVLWCSWLIEYENVKIYFTGDTAIGPHF
AEIKETIGRGPDLMIAGIGPTAPSGMMRTVHMDGKDAWNMAKDIGAAKLTPMHYGTFPLG
MKPAKTDLDIFMENAEHGKELVINIGGRIDWNGTEFVKADL
Download sequence
Identical sequences A2EJ55
XP_001319510.1.43485 87823.m00110 5722.A2EJ55 gi|121902295|gb|EAY07287.1| gi|123472635|ref|XP_001319510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]