SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001324587.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001324587.1.43485
Domain Number 1 Region: 241-491
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.77e-86
Family Ankyrin repeat 0.0000488
Further Details:      
 
Domain Number 2 Region: 84-205
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000589
Family Pseudo ankyrin repeat 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001324587.1.43485
Sequence length 497
Comment ankyrin repeat protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MINTNLIDSKNHLPETIIKDIIDIIPYNNRYTKSYLSLAKLISDNYQVKEVNTVIHISNF
LFYKEYGIKLDKYDNFEKDNFKNLDIHTENTIYRAIMNNDLEIFISFTEREGFDKYQILQ
SNLYPYTKEGYSLLELCCYHGAVDCFKFLRTKFNSRITEICLQFSFLGGNQEIMSECLKN
KKPDKKCMEYAIISHNIDFVTFLVNEYDLEIDLEYCRKYKNLESFLVVLDQSKFLINSFI
LSPMFNIPSICQYFLSHGVDINETDDYQRTALHSAVEYNSKETAEFLISHGANINKKDKD
RQTALHYAAIFNRKETAELLISHGANINEKDKCKKTALHSAAEYNSKEIAALLISHGANI
NENDKFRKTALHYAAEKNTKEIAELLISHDANINKKDKCKKTALHYAVENKSKEIVELLI
SHGANINEKDEKMKTALHYAAEKNSKETAELLISHGAYINEEDNYGETALEIARDHVCTD
TAKLLLSFGAKDKQMFI
Download sequence
Identical sequences A2E4Q4
5722.A2E4Q4 88516.m00187 gi|121907472|gb|EAY12364.1| gi|123485854|ref|XP_001324587.1| XP_001324587.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]