SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001326135.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001326135.1.43485
Domain Number 1 Region: 676-776
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000017
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 
Weak hits

Sequence:  XP_001326135.1.43485
Domain Number - Region: 3-97
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00877
Family Calponin-homology domain, CH-domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001326135.1.43485
Sequence length 777
Comment surface protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MAEQQKATKWLQQFLAIKGGSFTHIGTAFQDVQNLNIVIQLLTDEKDANYETINDALEAI
LNHKLMPKWDRLQETDINQSNMQKIVQFVNRLAGQYTIDQVKKDNANAKPSAKPAQKLPS
PKSSAAAAPAPAHKPKPEKTSSVETTHLAKPPSPTSNSKPSPAAQSKPAEEDATISRSDF
VSRPMMNKHRSNTIAPKRAAESILAAQAAIAGKPITPKAADTNSRPISRGSPREISPKSS
DSDKPNSFKARLAFAQSNLAHQNALNPSAKISCNPPGHRNTSPTKPQPTFAEEPPKEEEK
PVTRPALRPVPKEEPKKEVEEEKLVIKPALRPVPKEEPKKKVEPEKPISKPALKPVPKEE
PKPEPKPVPKPEPKKEEPKKEEEEKPISRPPLRPVPKKEEEEKPVIKPALKPVPKEEPKP
EPKKEEEEKPKEVEEEKPKPAFKPEPKKEEKPRASFNLPKKEEEEKKETPEPTKEEEENK
EAPKPTENEVLPPPKPVLTTDEVCVNSDMLNFPTAFRRTRRNTVFVKRPSLKDVSPKEPE
RPKPAESPVMRPAAMAGIPDQFSSPVAGGGGRARRPPMPGMGPGMPMPGLGAGMPKLRKV
NQPGVPVYTKNEAGTPRPGKEEKKKEEKKEKKEKDPKLNEVPKPSGGGFFKKLFGKDKGK
EEKTKEKSPKSSGNDINGWLSLMGVEVSNIATDFKDGTNLIKLIKSMTGDEIEVKPVKPA
LLKFQNPNLDEAIKYFDSKNLTAGKNHISKDDFMNGNENNIKNFLAGLMSKYPKPKK
Download sequence
Identical sequences A2E0B2
gi|121909045|gb|EAY13912.1| gi|123492749|ref|XP_001326135.1| XP_001326135.1.43485 81244.m00221 5722.A2E0B2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]