SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001326273.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001326273.1.43485
Domain Number 1 Region: 293-517
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.94e-80
Family Ankyrin repeat 0.00005
Further Details:      
 
Domain Number 2 Region: 135-252
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000209
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001326273.1.43485
Sequence length 536
Comment hypothetical protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSNQDIHPNKYSELRSICKYYIDSYIALYQLKTEKEEELKDIYKIIKTELIDSKKYPPKN
IMEDILNIIRYNNRYTKSYLSLAKLISDDYHVEKVKNIPMISILLFYKEYGIKLDKYLNF
KNFNSVNMDIHTENTIYRAIMNNDLETFILFTEREGFNKDQKLESSLYPFSFKSYNGYSL
LELCCYHGAVDCFKFLRTKYGSEITQKCLQLSFLGGNPEIMSECLKYQKPDKFCMEYAII
SHNINFVTFLMNEFNIEIDLDYCVQYNNLESFLVYFDQTNDINACFFNSTRFNIPSLCKY
FLSNGANINTKDKHEETALHKAARYDSKEIAELLISHGININEKNKYGETTLHRAARYDS
KETAELLISHGANINEKDNEGESALHIAAYDNSKETAKLLISHGININEKNNNGRTALHN
ATRCDSKETAELLISHGININEKNNNGETVLHKAIFYNSKETAKLLISHGININEKNNNG
RTALRIAAFNNNKETVELLISHGANTNEKDNMGDTPFILQQLIIVKKQPNFLFHMV
Download sequence
Identical sequences A2DZZ1
XP_001326273.1.43485 gi|121909185|gb|EAY14050.1| gi|123493375|ref|XP_001326273.1| 5722.A2DZZ1 96800.m00256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]