SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001328558.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001328558.1.43485
Domain Number 1 Region: 293-551
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.42e-87
Family Ankyrin repeat 0.0000228
Further Details:      
 
Domain Number 2 Region: 125-250
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000418
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001328558.1.43485
Sequence length 621
Comment ankyrin repeat protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MSDKDIHQDKYSELRSKYKYFIDSFNALYQLKAENEEDLNKIYKMIKTELIDSRKYLPVN
IIRDIINIIPFNNRYTKEYLSLAKLISDDYHIKEVNNVIDISNFLFYKEYGIKLTKFYEF
ENNNIENLDVLTENTIYRAIMNNDLERFISFTELEGFDKNQRLKSELYPCFFKDYSLLEL
CCYHGAVDCFKFLRTRFNLKITEECLEFSFLGGNQEIMSECLKYQKPNKMCMKYAIISHN
IDFVTFLMNEYNMEIDLNFCGKSNNLESFLVYFDQTNDINIVFVYSTMFEIPSFCEYLLS
QGAKINEKDANGKTALHIAADSNSKDMVEFLISHGANINEKDKYGFTALHIVAENNNLEL
AELLIAHGANINEKDKNGKTALHIAIENKCKETAELLIIHGANINEKDKYGKTALHIAIE
NNNEITELLILHNANINEKDGNGKTALHLAMDNNCKEIAELLILHGANINERNIYGFTAL
HIAARNSKETTELLILHGANINEKDKYGKTALHIAIENNNEIAELLILHNANINEKDGNG
FTALHLATLKKARKRQNILLHMVPISMKKIIMDSHLFVLQKIVIIQKQPNFLFHMAQKIV
FMHNILLFLILSKMNFIRNKK
Download sequence
Identical sequences A2DT63
92757.m00287 XP_001328558.1.43485 gi|121911503|gb|EAY16335.1| gi|123503644|ref|XP_001328558.1| 5722.A2DT63

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]