SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001329684.1.43485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001329684.1.43485
Domain Number 1 Region: 226-578
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.3e-90
Family Ankyrin repeat 0.00000913
Further Details:      
 
Domain Number 2 Region: 77-204
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000288
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001329684.1.43485
Sequence length 588
Comment ankyrin repeat protein [Trichomonas vaginalis G3]; AA=GCF_000002825.2; RF=representative genome; TAX=412133; STAX=5722; NAME=Trichomonas vaginalis G3; strain=G3; ATCC PRA-98; AL=Scaffold; RT=Major
Sequence
MIIEAVQMAAAFNNKYFRSYLKIFKKVYEEYHPAIYTPPSPAMLYFLYMDYGVLAFGITL
QTIQKLELKGFVLDVHPENTIYRAIMNDDIQSFIAFTERAGFDENQRFYNDFYEYSSRGY
TLLELCCYHGAVNCFKLLRTKFNSIISEKCLQMSFLGGNQEIMSECMKQVKPNKECMRYA
IMSHNNDFVSFLAEECNIEIVANECYLFYNLQALFILLDRTKDIGSCLVKSAYFNIPSLC
EYFLQHGANVNAMESDKFGMTAIHVATQFFNFETANFLLANGSDINIKSKIGLNPLHIAA
GKCGKEVLEFLISHGSDIKAKTREGNLAIHMAAISNQVKNTEYFLDHGFDINERNNEGVT
PLHIAVKYHSNDVADFLIQRGANINSKDLFDGTPLHFAARCKNREMVEVLVLLGADINAR
DNHQRTPLHCAGESTDTGAAEVLIAQGSDINAIDDVGFTVLHYAAEINCVKTAIFFISHG
ANVDAMAFANETPLIVAAAKNSTRVAEILILNGANINHKGIYGDNALHICAKYGSLNVAA
ILVKHGIDIKAKNFGGITPLEVAQRSRNFGMVIYLNMLYKAYGNLPNI
Download sequence
Identical sequences A2DPV3
5722.A2DPV3 95940.m00213 gi|121912731|gb|EAY17549.1| gi|123508647|ref|XP_001329684.1| XP_001329684.1.43485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]