SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001342303.3.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001342303.3.45394
Domain Number 1 Region: 434-527
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.41e-17
Family Tudor domain 0.0019
Further Details:      
 
Domain Number 2 Region: 306-383
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001342303.3.45394
Sequence length 596
Comment A-kinase anchor protein 1, mitochondrial isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MPVLVRPLVSVTVLTLLGWCWYSFRRRRKIKASLWTEEEKCLLDGSSPVQFSPTDNGVLG
QSDLKMNQNISRSPEITELTDTSPFVEMHKFTSTSPVIGLNERVRPEPEGEVSIRFPETN
QSKKEKDDFTGEVHEDDFTDDKDGSSLSDFSPEQSQENMEIISSVLVQQVIHTTENQHSS
DPLSRPPNSGFQSASQDLVQHQSISGDDNDRETGSFRKKLLSDLGASVGDDSGCNSSFSE
DVSGSEGLTCEISEEEQSFLMTESDTTSIDGKMIPSILGEGEEEAWHGSGVESCIVADTQ
MSSLAPPPSPPIIQWDIEVPTHLVGRLIGKQGKFMNFLKQSSGAKIYVSTLPFTHDIQIC
HIQGSQQQVDEALSLVRKKFKDLDLSNCAPLPCLPITSWLLLPQDVFVEVMVSRVEAAHH
LFVHQHSHPSHQVLPTLIQAMQLCYSQPGCPSLPTPVEVGVVCAAPVTGSGWQRAQVIQY
DGETGTTHIRYVDSGGYDTVNSTTLRQIRSDFVTLPFQAAEVLLDNIMPLPGDEEFSLEA
KEALEESTANVALILKVTGSQDGLPLVHLWKQAGDEMVLINRSLADQGFFSWFDTQ
Download sequence
Identical sequences E7FBS7
ENSDARP00000106494 ENSDARP00000122242 ENSDARP00000106494 XP_001342303.3.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]