SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001348351.2.26446 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001348351.2.26446
Domain Number 1 Region: 120-196
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0000347
Family Cdc48 domain 2-like 0.011
Further Details:      
 
Weak hits

Sequence:  XP_001348351.2.26446
Domain Number - Region: 80-113
Classification Level Classification E-value
Superfamily ADC-like 0.0199
Family Cdc48 N-terminal domain-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001348351.2.26446
Sequence length 282
Comment Ubiquitin fusion degradation protein UFD1, putative [Plasmodium falciparum 3D7]; AA=GCF_000002765.3; RF=representative genome; TAX=36329; STAX=5833; NAME=Plasmodium falciparum 3D7; AL=Chromosome; RT=Major
Sequence
MWGFSNFNNLWPRDFLNVSEPFQEEYTCYPVSFIGKDDMENGNKIILPQTALNALARRHI
SWPMLFEVSNPYTDKRTHSGVLEFISDEGTCHMPYWMMQQLNLKEGDIVRVTSVSLPKGT
FVKLKPCSKDFMELSNHRAVLETALRNYATLTIGDNIVIHYLGKTYEIKIVDLKPAFACT
IIETDVEVEFEEPIDHSEPVQYVTEIVPEEENKFKGKGQRTDGKSCHKALKKEIIKPKVV
ENLEPWKDKLAQGIRTKCTEYEDLLKKGRIPGIVGKFTERKN
Download sequence
Identical sequences A0A024W0Q3 A0A024WGG2 A0A024X0E5 A0A0L7KKU3 A0A2I0C2Z5 Q8ILR6 W4I8V1 W4IUZ8 W7F9Y9 W7FER4 W7J681
PF14_0178 gi|255528789|gb|AAN36790.2| gi|258597686|ref|XP_001348351.2| XP_001348351.2.26446 PFHG_04059T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]