SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001348360.1.26446 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001348360.1.26446
Domain Number 1 Region: 86-207
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.9e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.00000102
Further Details:      
 
Domain Number 2 Region: 7-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.57e-28
Family Glutathione S-transferase (GST), N-terminal domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001348360.1.26446
Sequence length 211
Comment glutathione S-transferase [Plasmodium falciparum 3D7]; AA=GCF_000002765.3; RF=representative genome; TAX=36329; STAX=5833; NAME=Plasmodium falciparum 3D7; AL=Chromosome; RT=Major
Sequence
MGDNIVLYYFDARGKAELIRLIFAYLGIEYTDKRFGVNGDAFVEFKNFKKEKDTPFEQVP
ILQIGDLILAQSQAIVRYLSKKYNICGESELNEFYADMIFCGVQDIHYKFNNTNLFKQNE
TTFLNEDLPKWSGYFEKLLKKNHTNNNNDKYYFVGNNLTYADLAVFNLYDDIETKYPSSL
KNFPLLKAHNEFISNLPNIKNYITNRKESVY
Download sequence
Identical sequences A0A024V1C7 A0A024W1R6 A0A024WV71 A0A024X1P1 A0A060RZA0 A0A144A1J6 Q8ILQ7 Q8MU52 W4I8T1 W4IVI0 W7FES3 W7FLF0 W7J689 W7JY33
XP_001348360.1.26446 XP_012765252.1.2076 5833.PF14_0187-1 1oktA 1okt_A 1okt_B 1pa3_A 1pa3_B 1q4j_A 1q4j_B 3fr9_A 3fr9_B 3frc_A 3frc_B gi|124808609|ref|XP_001348360.1| gi|23497253|gb|AAN36799.1| gi|75016047|sp|Q8ILQ7.1|GST_PLAF7 PF14_0187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]