SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_001358773.1.19638 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001358773.1.19638
Domain Number 1 Region: 623-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000321
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 340-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000189
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 4 Region: 676-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000243
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 540-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000159
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 6 Region: 594-648
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000553
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 7 Region: 479-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000195
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  XP_001358773.1.19638
Domain Number - Region: 422-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00103
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number - Region: 1262-1289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00664
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001358773.1.19638
Sequence length 1290
Comment uncharacterized protein Dpse_GA20743 [Drosophila pseudoobscura pseudoobscura]; AA=GCF_000001765.3; RF=representative genome; TAX=46245; STAX=7237; NAME=Drosophila pseudoobscura pseudoobscura; strain=MV2-25; AL=Chromosome; RT=Major
Sequence
MNHQNYGGIQWIQQHPAASDSGVDILVGDGEDGVTPDGYHLVTDEATGEDLDHMAAENLI
FMARDGQLSEIIAGGNAVIVTADGHGVTYADSFDDDAQVVTEEVITDDWVQHQGAERVEI
AAEQIAGNGSSQELLDMEQDEYTALRPYPCDFCSRRFKKKSSLNTHMLAHQNDRPHLCKL
CGSRFSRRAELISHFKAHAEAQDAADAEAAAATSIKFEHRPMDDHYYEHEWPLYQQDQDA
EDQQQMVSSSETQLVHQDSYNVAAVTVDAPVPTRGRISRLKPKEEASQYIVISDKTEAPQ
MQDYMQSEPMQAVVTTSTAIEPPPKADLPQPNYPVLDDSKPFVCQQCGLAFAREKALFSH
TKNHRVDSPFECNLCQEMFWDNSSLLEHQKTHQFEESNSEYDPASGDDSVSESEPDQLYG
DFYCSECGICFHRQDLLRRHAKCHFQQPDASNFDQKPIVGEVGVTDEVIAGDAENAKDDA
AHRCHTCGKCFPNSVALSAHAEMHARFPLFKCVLCGVSFYEEQSIKRHLHSRHPNELKAN
SCVLCGKECRDRKALIKHAWDHSREKCHSCSKCGKNFHNKARLKRHMASHRDKSVVCEVC
QEEFPDGRTLSNHRHSHSTTSPGKLFPCLECGKTFGSRSSQQIHVRIHTGERPYGCRYCW
KAFADGGTLRKHERIHTGEKPYACSVCPRAFNQRVVLREHIRSHHSGMDVTLGTYHCEVC
SEDLSSSSELIQHLIKHSDTNTAKQRQPVTGPRKYKRRRKLQPHEIAHMRAENKEDELLQ
EAEEYNSDLDICDFDVENVDRIFEMAESPKKEKRKKGAAKDPKAVANGTTKAVTDKSKMR
YDSTSSHSDRMWEEKFLQDNQVSLFQIDSLAAMNQQQSPLPTSTASSSSVQNTRRSSKQS
QAQGQAKTAPPVEVKANTSASSSSTTASSSSRSRKKAGTSKAASSKSAAAGSSRPRMIHT
EKAKVPKSSESSGTASASTKKTRGKSYITRTETSNLDLLSSSGSGKSRSTASNIVDDYEI
ISPATHPPNQISSSPLHIKQEQEQQRVPMMYDDNLLIDAALLREKTYERFNPAIVNDLEE
ILRSPLKSEHNSRLRFTSESSTTPQFLPGEEQNLIKIEPTSPDLREMVESQQRVTATTGN
TPSSSSSSARTSRHLRQITANSPRVGSKRSSSSRPDSASGTAAKKPTTSSSSSPVAAGSK
TRSSEHSYLSYGVGVDSYNVNVPASANTADVSSAFFSISEVVSAADAADAAAKAAAASKS
DRKKRSFECEMCSAIFYDRAQLLDHVHIHI
Download sequence
Identical sequences Q298N9
XP_001358773.1.19638 FBpp0282024 7237.FBpp0282024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]