SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001362652.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001362652.1.35504
Domain Number 1 Region: 51-174
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-21
Family Synaptotagmin-like (S variant) 0.035
Further Details:      
 
Domain Number 2 Region: 222-271
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000957
Family CUE domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001362652.1.35504
Sequence length 274
Comment PREDICTED: toll-interacting protein [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGALNTVGRLNITVV
QAKLAKNYGVTRMDPYCRIRLGYAVYETATAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLKQGKVEDEWYSLSGRQGDDKEGMINLVMSYSSLPTAMM
TQPQPVVLMPTVYQQGVGYVPITGVPAVCGPGVMPLAVAPPVVSPPAPCSEDDLKAIQDM
FPNMDREVIRSVLEAQRGNREAAINSLLQIGEES
Download sequence
Identical sequences H9H7K3
ENSMODP00000025652 XP_001362652.1.35504 ENSMODP00000025652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]