SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001362692.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001362692.1.35504
Domain Number 1 Region: 61-109
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.57e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 310-355
Classification Level Classification E-value
Superfamily UBA-like 0.00000000408
Family TS-N domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001362692.1.35504
Sequence length 531
Comment PREDICTED: doublesex- and mab-3-related transcription factor A2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MELRSELPSVPSAAGPPVAPGSVASVASVAAAAAAAASLPVSVAGGLLRAPPLLLRAAEK
YPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEE
NEARELQLLYGTAEGLALAAANGIIPPRPAYEVFGTVCPDSASGAGPGPGPGSVPGGAGG
GPGGTEAKLQKFDLFPKGLLQPGGAASPQPPGGKPVSPDGADSAPGTSSPEARPGSGSEN
GDGDSFLGSPLSKALKEGGGGGGGSGSGSGGGGPGDDDSPGSISPLGSDSGSEADKDEAT
ASPPPSGSGPGPRQRTPLDILTRVFPSHKRSVLELVLQGCGGDVVQAIEQILNHHRGAAV
AGGAAVAAVAAGGLDKGPDESWTGRADGSGGALGAALQPGPATAHHPHHRPLLAGAMTPA
IGTLGSRSAFSPLQPNASHFGAEAGAYPLGTPLGLSPLRLAYSAAAHSRGLAFMAPYSTA
GLMPTLGFRPPMDYAFSDLMRDRSASVHKEPVYSNGGGLYGPLVNNTPDKQ
Download sequence
Identical sequences F7CJ78
ENSMODP00000001502 XP_001362692.1.35504 ENSMODP00000001502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]