SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001363069.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001363069.2.35504
Domain Number 1 Region: 358-487,794-969
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.18e-53
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 91-214
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-29
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 
Domain Number 3 Region: 1174-1238
Classification Level Classification E-value
Superfamily SAM/Pointed domain 5.14e-20
Family SAM (sterile alpha motif) domain 0.0044
Further Details:      
 
Domain Number 4 Region: 261-329
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.38e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000373
Further Details:      
 
Domain Number 5 Region: 200-256
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000404
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001363069.2.35504
Sequence length 1247
Comment PREDICTED: diacylglycerol kinase eta isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MEPQHVHSPYSARSPVWEELESERMAGAGVQHHPPGTAGASTAASTAATTASATAAAAAG
PVEESSDSEAEHEGPQKLIRKVSTSGQIRSKTSIKEGLLLKQTSSFQRWKKRYFKLRGRT
LYYAKDSKSLIFDEVDLSDASVAESSTKNVNNSFTIITPFRRLVLCAENRKEMEEWISLL
KSVQSRELYEAAQFNVEHFSGMHNWYACSHARPTFCNVCRESLSGVTSHGLSCEVCKFKA
HKRCAVRATNNCKWTTLASIGKDIIEDEDGIAMPHQWLEGNLPVSAKCAVCDKTCGSVLR
LQDWKCLWCKAMVHTACKELFPYKCPLDQCKVSTIPPIALNSIDSDGFWKATAPPSRASP
LLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLINGGPHLGLRLFQKFDNFRILVCGGDG
SVGWVLSEIDKLNLHKQCQLGVLPLGTGNDLARVLGWGGSCDDDTQLPQILEKLERASTK
MLDRWSIMTYELKLPTKPSLLPITSEEENEESHISSYEDSVATHLAKILNSDQHSVVISS
AKILCQTVKDFVAKVGKTYERTEENSDVADTMALKCEILNEKLDQLLQTLHAEAQTVPVY
KHHGLPSSDEEPINFSSDESLSENKARLMEDAPKITSQKTLKPRELMLRANSLKKAVRQI
IEQAEKVVDEQNVHIDEEGNLMSSPLDDSKETEYSKDDDGKEYTSVKTATRAPETCLSQS
CSTSTSISGPILTSNKENLPVLNARIICPGLRAGLAASIAGSSIISKMLLANIDPFGATP
FIDPDPESLEGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNMMWYGVLGT
KELLQRTYKNLEQRVQLECDGQYIPLPSLQGIAVLNIPSYAGGTNFWGGTKEDDIFTAPS
FDDKILEVVAVFGSMQMAMSRVIKLQHHRIAQCRSVKITILGDEGVPVQVDGEAWIQPPG
IIKIVHKNRAQMLTRDRAFENTLKSWEDKQKYDAGKVPPRPQQYLQQAVDLATEEEVNLM
QHCSQAAEELITRICEAAKVHSLLEQELAHAVNACSHALNKANPRFPESLTRDTAIEIAV
NVKALNNETESLLIGRVPLQLESPHEELVTNALHGVEVELQKLSDIPWLHGVLHSNDDED
PPLDYTKRNKSTMFRIVPKFKKEKVQKLKGSPLPVQKWGTDEVAAWLDQLNLGEYTEIFI
RHDIRGAELLHLERRDLKDLGITKVGHMKRILQGIKELGKSTLLSEV
Download sequence
Identical sequences F6UU82
ENSMODP00000036353 ENSMODP00000036353 XP_001363069.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]