SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001364941.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001364941.1.35504
Domain Number 1 Region: 28-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.92e-88
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 277-399
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-32
Family Spectrin repeat 0.000000755
Further Details:      
 
Domain Number 3 Region: 513-634
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-31
Family Spectrin repeat 0.00000417
Further Details:      
 
Domain Number 4 Region: 401-508
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-24
Family Spectrin repeat 0.00000273
Further Details:      
 
Domain Number 5 Region: 742-887
Classification Level Classification E-value
Superfamily EF-hand 2.9e-22
Family EF-hand modules in multidomain proteins 0.0083
Further Details:      
 
Domain Number 6 Region: 638-749
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-20
Family Spectrin repeat 0.00000308
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001364941.1.35504
Sequence length 897
Comment PREDICTED: alpha-actinin-3 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MMMVLQPDGLGEGQGPYGGGEYMEQEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGT
QIENIEEDFRNGLKLMLLLEVISGERLPRPDKGKMRFHKIANVNKALDFIASKGVKLVSI
GAEEIVDGNLKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYRNVNVQNFH
TSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKYLDIPKMLDAEDIVNT
PKPDEKAVMTYVSCFYHAFAGAEQAETAANRICKVLAVNQENEKLMEEYEKLASELLEWI
RRTVPWLENRTGEPSMSAMQRKLEDFREYRRLHKPPRVQEKCQLEINFNTLQTKLRLSHR
PAFMPSEGKLVSDIANAWRGLEQAEKGYEDWLLAEIRRLQRLQHLAEKFQQKASLHESWT
RGKEDMLSHRDYESASLQEVRALLRRHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAA
SVNSRCQAICDQWDSLGTLTQKRRDALERMEKLLETIDQLQLEFARRAAPFNNWLDGAVE
DLQDVWLVHSVEETQSLITAHEQFKATLPEADRERGAILGIQGEIQKICQTYGLRLSSSN
PYISLTPQDITSKWEMVRKLVPSRDQTLQEELARQQANERLRRQFAAQANAIGPWIQGKV
EEVGRLAVGLAGSLEEQMAGLRQQEQNIINYKSNVDRLEGDHQLLQESLVFDNKHTVYSM
EHIRVGWEQLLTSIARTINEVENQVLTRDAKGLSQEQLNEFRASFNHFDRKRNGMMEPDD
FRACLISMGYDLGEVEFARIMTMVDPNAAGVVTFQAFIDFMTRETAETDTAEQVVASFKI
LAGDKNYITGEELRRELPPEQAEYCIRRMAPYTGPGAPSGALDYVAFSSALYGESDL
Download sequence
Identical sequences F7EL30
13616.ENSMODP00000010140 ENSMODP00000010140 XP_001364941.1.35504 ENSMODP00000010140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]