SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001365104.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001365104.2.35504
Domain Number 1 Region: 27-116
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-22
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 2 Region: 108-217
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000353
Family Fibronectin type III 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001365104.2.35504
Sequence length 524
Comment PREDICTED: interferon lambda receptor 1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAKSSLWAPLLLCLLRPAPGSPELALPQNVTLLSRNFRVYLTWLPGPNYPLNVTYVVHYQ
SFENETNWKKAKHCLRIAIRECDLTCLKHLDPFLKFKGRVRAVVQGTYSLWAESKYLEYF
IDVEPAPPILTWILTEKTLIVNATNELPSCAYLMNLKYKVEFWKEGSPNKTETQVRFHEM
AVINLPPASTGRYCLRARTVYVLTTPKYSEFTKPVCFLLGTSGTQDGILALVLLVFLPII
ILIFCMCFLKKVYFQKAKMPQSLDFPGYRWPVKILELTRQESFRDLFICPKTSLEQKRPC
AGSRGPSIAPPSEMEDHETEEESKEGDSEDSDDSGTFEAYLEIAPIKSLMIRMAKTKTET
QSLESLESLTHHPQGDFSPDTSDSKNESESFWKQSGVINYLIKDPLCEDGLALPPPVFMK
KSELVEESSKGDLSSRDSLVPLGPTSPGLVFIPEEPLVSLKTLIINMDRGTQDRSEEEEE
EEEEEEEEENCLMKDTSGGNEVEGPWSEYPKRPKVSDYQHYRLH
Download sequence
Identical sequences F7G0V4
ENSMODP00000016333 ENSMODP00000016333 XP_001365104.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]