SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001365390.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_001365390.1.35504
Domain Number - Region: 123-153,183-211
Classification Level Classification E-value
Superfamily SET domain 0.0785
Family RuBisCo LSMT catalytic domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001365390.1.35504
Sequence length 308
Comment PREDICTED: palmitoyltransferase ZDHHC7 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MQSSGHRFRDVEHHPLLAENENYDSSSSSSSEADMADRIWFIRDGCGMVCAVMTWLLVVY
ADFVVTFVMLLPSKDFWYSMINGVVFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMES
LQLKPGEVIYKCPKCCCVKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTM
YIALSSAHALILCGFQFFSCVRGQWTECSDFSPPVTVILLIFLCLEGLLFLTFTAVMFGT
QIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGQPSILWMNPFAGFRIRRFLLKSK
RGGPEFSV
Download sequence
Identical sequences F6UNB8
13616.ENSMODP00000005723 ENSMODP00000005723 XP_001365390.1.35504 ENSMODP00000005723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]