SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001366168.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001366168.1.35504
Domain Number 1 Region: 322-395
Classification Level Classification E-value
Superfamily F-box domain 4.32e-16
Family F-box domain 0.0038
Further Details:      
 
Weak hits

Sequence:  XP_001366168.1.35504
Domain Number - Region: 2-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00103
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001366168.1.35504
Sequence length 518
Comment PREDICTED: F-box only protein 7 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MKLRVRVRKRTAPLELPGAEPTLGELRAHLRQALLPAWGYSSDIQFAVTLNSKDALTEDE
KTLAEYGIVCGDLICLVLEEATEDLPRASLDLAHSSFASNHDQPSLATSQSLRSRQGERE
LNDPYSAVQSAESMPGSSLDLDSGLIQEDVDMEEGTGGYPSEPMLCSEAVDGQVPHSLEM
LYHSAECSSTNDALIVLVHLLMLESGYIPLGTEAKAVSMPENWRSGGVYKLQYMHPLCED
GTAALTCVPLGSLIVINATLKINNEIRSVKRLQLLPESFICPPKQAEEQVASKYKDLQKL
SRLFKDQLVYPLLAFARQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLALSAVCRDLFN
ASNDQLLWRFMYLRDFRDGAVRPRDTDWKELYRKQKQRKDALRWRHAMFLPPPPHPMPFH
PSPFYPSPFPPNPMYPPGIIGGEFDERPVLPYVGDPINSLIPGPGEAPGQFSPFRPHFDP
MGPFPGPNPVLPGRGGPSDRFPFRPSRGRPTDIRLSFI
Download sequence
Identical sequences F7FWC2
ENSMODP00000001615 ENSMODP00000001615 XP_001366168.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]