SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001368498.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001368498.1.35504
Domain Number 1 Region: 13-273
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.7e-40
Family WD40-repeat 0.0057
Further Details:      
 
Domain Number 2 Region: 283-372
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.76e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  XP_001368498.1.35504
Domain Number - Region: 362-395
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.033
Family Quinoprotein alcohol dehydrogenase-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001368498.1.35504
Sequence length 400
Comment PREDICTED: WD repeat and FYVE domain-containing protein 2 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAAEIQPKALTRKPILLQRVEGSQDVVNMAVIVPKEEGVISVSEDRTVRVWLKRDNGQYW
PSIYHTMPSPCSCMSFNPETRRLSIGLDNGTISEFILSEDYNKMSPVKNYQAHQSRVTMV
LFVLEMEWLLSTGQDKHFTWHCSESGQRLGGYRTNSGPSGLQFDVDTRHVFVGDHSGQVT
ILKLEQETCSLVTTIKGHTGGVTALCWDPVHRVLFSGSSDHSVIMWDIGGRKGTAIELQG
HNDKVQALSYAPHTRQLISCGGDGGIVVWNMDVQRQETPEWLDSDSCQKCDQPFFWNFKQ
MWDSKKIGLRQHHCRKCGKAVCGKCSSKRSSIPLMGFEFEVRVCDSCHQSITDEERAPTA
TFHDSKHNIVHVHFDATRGWLLTCGTDKVIKLWDMTPVVS
Download sequence
Identical sequences F7D654
XP_001368498.1.35504 ENSMODP00000013195 ENSMODP00000013195 13616.ENSMODP00000013195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]