SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001370108.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001370108.1.35504
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-86
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 267-389
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-32
Family Spectrin repeat 0.000000602
Further Details:      
 
Domain Number 3 Region: 503-623
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-31
Family Spectrin repeat 0.00000355
Further Details:      
 
Domain Number 4 Region: 390-498
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-26
Family Spectrin repeat 0.00000325
Further Details:      
 
Domain Number 5 Region: 627-739
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-23
Family Spectrin repeat 0.00000228
Further Details:      
 
Domain Number 6 Region: 732-864
Classification Level Classification E-value
Superfamily EF-hand 1.78e-21
Family EF-hand modules in multidomain proteins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001370108.1.35504
Sequence length 892
Comment PREDICTED: alpha-actinin-1 isoform X2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTVPWLENR
APENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKM
VSDINNAWGGLEQAEKGYEEWQLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLQQK
DYEIATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYNSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERQAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALMEEHSRQQQNERLRKQFAAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLNHLRQYEKSIVNYKPKIDQLEGDHQQIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRIGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITLDELRRELPPDQAEYCIARMAPYTGPDAVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences XP_001370108.1.35504 13616.ENSMODP00000012741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]