SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001372323.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001372323.1.35504
Domain Number 1 Region: 296-416
Classification Level Classification E-value
Superfamily TIMP-like 7.22e-37
Family Netrin-like domain (NTR/C345C module) 0.00024
Further Details:      
 
Domain Number 2 Region: 34-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-35
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 155-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001372323.1.35504
Sequence length 416
Comment PREDICTED: procollagen C-endopeptidase enhancer 2 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MRDASCIRSWLWLLLAASAQVSGQQPQERPVFTCGGILSGESGLIGSEGFPGVYPPNSKC
TWKITVPEGKVVVLYFRFLDLESDNLCRYDFVDVYNGHTNGQRIGRFCGTFRPGALVSNS
NKMLVQMISDANTAGNGFIAMFSAAEPNERGDQYCGGRLQRPTGSFKTPNWPDRDYPVGV
TCLWHIIAPKNQVIEVKFEKFDVEQDNYCRYDYVAVFNGGEINDAKRIGKYCGDRPPAPI
VSERNELLIQFLSDLSLTADGFIGHYKFRPKKLPTTTVLPITTTSPAPTSSRPTVALCQQ
KCRRIGTLESNYCSSNFVLAGTVITTMTKGGSLLATVSIINVYKEGNLAIQQAGKNMSTK
ITVVCKQCPLIRRGLNYIIMGQVDEDGRGKITPNSFIMNFKMKNQKILNALKNKRC
Download sequence
Identical sequences F6TZS0
XP_001372323.1.35504 ENSMODP00000026549 ENSMODP00000026549 13616.ENSMODP00000026549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]