SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001372743.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001372743.1.35504
Domain Number 1 Region: 199-343
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-45
Family Third domain of FERM 0.00000026
Further Details:      
 
Domain Number 2 Region: 88-198
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-38
Family Second domain of FERM 0.000000786
Further Details:      
 
Domain Number 3 Region: 498-586
Classification Level Classification E-value
Superfamily Moesin tail domain 1.05e-32
Family Moesin tail domain 0.0000249
Further Details:      
 
Domain Number 4 Region: 2-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-26
Family First domain of FERM 0.00000756
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001372743.1.35504
Sequence length 586
Comment PREDICTED: ezrin isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYVDNKGFPTWLK
LDKKVSAQEVRKESPLQFKFRAKFYPEDVPEELIQDITQKLFFLQVKDGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLGSERLIPQRVMDQHKLSREQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMLREKEELMMRLQDYEQKTKK
AEKELSDQIQRAIQLEEERKRAQEEAERLEADRVAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQIRAREAQDDLVKTKEELHQVMTAPPPPPPPVYEP
VNYHVHENLQDEGTEYSGYSAEFSSEGIMDDRNEEKRITEAEKNERVQRQLQTLTNELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAM
Download sequence
Identical sequences F7C4V4
13616.ENSMODP00000028777 XP_001372743.1.35504 XP_007484900.1.35504 XP_007484901.1.35504 ENSMODP00000009488 ENSMODP00000028777 ENSMODP00000009488 ENSMODP00000028777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]