SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001373459.3.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001373459.3.35504
Domain Number 1 Region: 257-286
Classification Level Classification E-value
Superfamily Moesin tail domain 0.0000209
Family Moesin tail domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001373459.3.35504
Sequence length 289
Comment PREDICTED: ermin [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MTEVSKETSLTECNGDVSPEKEITEISDEVFTSDGLSKYHDTDVNPEDSFSEGNLDENKY
SRASMICRDLAWSLEEDKHREEDFTVHKRIASLSLKETRAGEMTSEEGLQWEKIPPYGKV
QETTRLKKSGTEKLLEERDGGIRGNEEFQVAEMEDNLEWLGSQQPRKDAMMTKQDKEVED
GEQEIDNDNEDGGDDDDDDDEEEDEVRLIEFKKGNGRASHFKEEGNVSEDSPLSSPNSQP
ITPEELPALGKKNDISRHTYSRYNTISYRKIKKGNTKQRIDEFESMLHL
Download sequence
Identical sequences F6VTK3
ENSMODP00000005396 ENSMODP00000005396 XP_001373459.3.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]