SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001374298.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001374298.1.35504
Domain Number 1 Region: 15-273,356-396
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.18e-45
Family WD40-repeat 0.001
Further Details:      
 
Domain Number 2 Region: 283-367
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.49e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001374298.1.35504
Sequence length 410
Comment PREDICTED: WD repeat and FYVE domain-containing protein 1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAAEIHSRPQSSRPALLNKIEGHQDAVTAALLIPKEDGVITASEDRTIRVWLKRDSGQYW
PSIYHTMASPCSSMAYHHDSRRIFVGQDNGAIMEFHISEDFNKMNFVKTYPAHQSRVSAV
VFCLGAEWVISTGHDKCVSWMCTRSGNMLGKHFFTSWASCLQFDLDTQHAFVGDYSGQIT
LLKLEQNTCSIITTLKGHEGSIASLWWDPIQRLLFSGASDNSIIMWDIGGRKGRMLLLQG
HHDRVQSLCYLSLTRQLVSCSSDGGIAVWNMDVRREEAPQWLESDSCQKCEQPFFWNIKQ
MWDTKTLGLRQHHCRKCGQAVCGKCSTRRSTYPVMGFEFQVRMCDSCYDSVKDEDRTSLA
TFHEGKHNISHMSMDVARGLMVTCGTDRVVKIWDMTPVVGCSLATGFSSR
Download sequence
Identical sequences F6XE34
ENSMODP00000026495 ENSMODP00000026495 XP_001374298.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]