SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001376367.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001376367.1.35504
Domain Number 1 Region: 44-575
Classification Level Classification E-value
Superfamily Sema domain 8.93e-101
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1445-1568,1734-1915
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.61e-35
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 917-998
Classification Level Classification E-value
Superfamily E set domains 0.00000000000021
Family Other IPT/TIG domains 0.025
Further Details:      
 
Domain Number 4 Region: 1008-1097
Classification Level Classification E-value
Superfamily E set domains 0.00000000000084
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 5 Region: 1096-1176
Classification Level Classification E-value
Superfamily E set domains 0.00000000000175
Family E-set domains of sugar-utilizing enzymes 0.034
Further Details:      
 
Domain Number 6 Region: 578-630
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000379
Family Plexin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_001376367.1.35504
Sequence length 1958
Comment PREDICTED: plexin-D1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MAPPATGGAARSPRLLGVTTPLPLPLLLLLLTPLLAGSSALEIQRRFPSPTPTNNFALDG
PGGKVYLAAVNRLYQLSGPNLSLEVEEAVGPVRDNPLCHAPQLPQASCEHPKMLTNNYNK
ILQLDPGQGLVVVCGSVYQGFCQLRRLGNISAVAVSFPPTADGAEPVAVFPSMLNVAANH
PNASTVGLVLEPPSGVLGGASPGGTRLLVGATYTGLGSQFFPPNQSLEDHRFENTPEIAI
RSLDTRGDLAKLFTFDLNPSDDNILKIKQGVKAQHKLGFVRAFLHPGSSGAPETPHGRDG
PQMPANPAYAYLALNSEAKAGDKESQSHSLLARICLGWGPAGGPGGAAAETKKLTESYIQ
LKLHCGGQAGGEVFNRLVSVFPAAPGPSRPEDLLFGVFERAAPGGTGAATTRAQSALCVF
RFRDIEGAIRAARNACFVDPSPDVVAVLESVVQGTGPACEKKRNIQLQPEQLDCGAAHLQ
HPLSILQPLKATPVFRYQGLTSVAVASVNNYTVVFLGTANGRLLKINLNGTMDMMSRKSI
TVAYGEAVHHIMQFDPIDPSYLYVMTSYQMARVKVAVCDQYTTCTDCLAAEDAYCGWCAM
ETRCSLQHECANSTQPHFWTSASEGIQRCPSMTILPSEINIHKAYSGMIIQISGNMPSLS
GMEMACDYGNGIHTVAKVPGQDFSHQIAFCNFLPRDKYPDFPSDQDHVTVQTAVQVNGRN
IVWANFTIYDCTRTGRVYPHTACTSCLSTRWPCFWCIQQHTCVSNVSECGNTPNLTDSQG
CPRILPMPLAPVPTGGLQNIHVSLANTDFISQDLSLACNFGSDENFEATWVNASEIQCSN
VVLHTPQRSQIFPVNLQLKGKPDRFIDSPEKMTVEVYNCAMGSTDCSQCMGREDLGHRCI
WNEGCRLNQNPQPVTTTCPAPEIRKIEPLSGPLEGGTLLTIRGKNLGRRFSEVAHSTWIG
GVACEPLESRYIVSEEIVCWTGPSPSPFSDVITVNVSKEGKSRERYSYVLPVVYSMEPDI
GPKAGGTRVTIRGSDLGVGSELHVLVNDTKQCLNLVRTDSTITCTMPRGELLATVRVCVR
FEHKSCIGGNITFDYMRDPIITAISPRRSPVSGGRTITVEGSRFDMVQNVSMMVNYIGKE
QTLCKVLNSTLITCPSPGATANKSAPVNFFINGQPYEDEQVAMEDPGEPKNLLPSSRFSL
EYLPDPQFSTAKREKWIKHHPGEPLTLVIHKEHDNLGLECREYQVKIGQTSCEIQIVSDR
VIHCSVNESLSTSEGHLPITIQVGNFNQTIATMQLGESETAITVSVVICSVLLLLSIVGL
FVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLE
YKHFVTRTFFPKCSSLYEERYILPSQPLNSQGGAQVQETHPLLLGEWKVSMPDTARPNME
EGIALFSTLLNNKHFLIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLL
VDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLLCAIKQQINK
GSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLTQVKEKI
LEAFCKNVPYSQWPRVEEVDLEWFASSTHSYILRDLDDTSVVEDGRKKLNTLAHYKIPEG
ASLAMSLTDKKDATLSRVKDLDTEKYFHLVLPTDELIESKKSHKQSHRKKVLPEIYLTRL
LSTKGTLQKFLDDLFKAILSIREDKPPLAIKYFFDFLEEQAEKRGITDPDTLHIWKTNSL
PLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKE
IPEYRKIVQRYYKQIHDMTPLSEQEMNAHLAEESRKYRNEFNTKVAMAEIYKYAKRYRPQ
IMAALETNATTRRTQLQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_001376367.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]