SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001377107.2.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001377107.2.35504
Domain Number 1 Region: 453-530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-20
Family Complement control module/SCR domain 0.0034
Further Details:      
 
Domain Number 2 Region: 583-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.49e-19
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Domain Number 3 Region: 206-268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000393
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 4 Region: 333-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000102
Family Complement control module/SCR domain 0.00051
Further Details:      
 
Domain Number 5 Region: 273-327
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000621
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 526-586
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000629
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 7 Region: 395-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000236
Family Complement control module/SCR domain 0.00088
Further Details:      
 
Domain Number 8 Region: 89-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000616
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 9 Region: 155-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000341
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 10 Region: 37-95
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000524
Family Complement control module/SCR domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_001377107.2.35504
Sequence length 662
Comment PREDICTED: coagulation factor XIII B chain isoform X1 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MRLKGVAFTMILLFSGQLFAEGKSCAMPNVEHGRIAQYYYTFKNHYFPMNLDKKLSFFCL
AGYTSKTGKQEDITTCTSEGWSPKPECFKKCNKPDLNNGFFSDQKILYKIQETLHYRCDS
GYKTTGGKDEEMLQCLANGWSSEPNCNKELEICLAPELYHGNYSTSQKMFRVKEKLHYTC
DNGYLTTGGKRSEEAECHPYGWSFTPKCTRLTCSPLRAIENGYFNPTKKTYEEGDVVQFS
CLENYYLSGSDLIQCYNFGWYPEPPLCEERRNRCPPPPLPPNAKIKTHPNTFRHGEIIHI
ECELNFELEGSEEIHCEHGKWTPPPNCIEIKEKIACEEPPMIMNGSANFHSKIYYNGDKV
TYTCENGYHIKGSDEIICKKGKWTSPPKCMENNENCKTPPEIEHGTIVDELLPSYVTGSS
VEYRCNIYYLLSGSPKTLCVQGKWSTPPICLEPCTVNVGYMHNNNIEMKWNFEGERYFLH
GDNIDFICKQGYDLSSSTRPSELIVQCNRGQLKYPTCIRKEPEGKCGSPPVIRNGNAIGS
PQKSYENGSSIEYQCLDYHFLQGSKTAHCLQGQWTTPPMCLEPCTLSSTEMENNNLHLKW
SFDNRPYFFHGEYIEFLCKRNSFLAASFTEFDLRVQCHRGQLKYPQCIERSRTQYYEQPL
RI
Download sequence
Identical sequences F6WU37
13616.ENSMODP00000015808 XP_001377107.2.35504 XP_007481069.1.35504 ENSMODP00000015808 ENSMODP00000015808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]