SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_001377114.1.35504 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_001377114.1.35504
Domain Number 1 Region: 356-576
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-51
Family DBL homology domain (DH-domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 717-779
Classification Level Classification E-value
Superfamily SH3-domain 7.74e-16
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 577-702
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000295
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_001377114.1.35504
Sequence length 803
Comment PREDICTED: rho guanine nucleotide exchange factor 19 [Monodelphis domestica]; AA=GCF_000002295.2; RF=representative genome; TAX=13616; STAX=13616; NAME=Monodelphis domestica; AL=Chromosome; RT=Major
Sequence
MDYRPSPNFQPHLAAFCYGGSQTGPLGAIPGGPTKGREELSPTARHPVAVCQQESLSFAE
LPSPFELGPWPLEVPATSHGLLWPLPVGAQDTRLPTRKPSAFGDDALSEFLGGPRSPQHP
EPQRRTSLSSEKEKSAWRKMRVYQREEADAVFPEVGAGDPQPHPALELPRTLGMAVPSQV
GTKEPERRRFSASELMNRLQSAQRKATFSLRLGKGLTKDRGGVWAAREGRTPEKEQSCLE
TRVDDLVPPAPSGPGERDGCWPGTRPDPVEEAAPKAWIPHERRQSRFLLNSILYQEYSDV
ASDRELQRQKHEEDALVEEAEGEEEGPGPPRANLSPSSSFRAQRSARGSTFSLWQDIPDV
RSSGLLAIIGLQECKLQEARFELITSEASYIHSLSVAVGHFMGSTELAECLGAQEKQWLF
SKLPEVKATSERFLLELEQRLEEDILRFCVCDIVLRHCPAFRRVYLPYVTNQAYQERTYQ
RLLLKNPKFPSILSRLEEAPICQRLPLTSFLILPFQRITRLKMLVENILKRTGQGSRGED
MATKAFNELKKLVQECNASVQSMKRTEELIHLNKKIHFESKIFPLISQSRWLVRHGELVE
LAPSTMPAASATKPKLSSKAIYLHAFNDCLLFSRRKEMGKFAVFLYARMPEIQVKDLSLK
PQGIPGQVFLLQFLQKCQPKNQLLLRAQTESEKRRWISAMCPSSSEEDKDAINENEDIPQ
VQCIKAYKALEPDELTLEKADILAVRTRTSDGWLEGIRLADGERGWVPQAYVDEITSRSA
RLRNIRETRRIESATNKLQGIAA
Download sequence
Identical sequences F7EFQ7
ENSMODP00000004035 XP_001377114.1.35504 XP_007491716.1.35504 ENSMODP00000004035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]